General Information

  • ID:  hor001905
  • Uniprot ID:  P45644
  • Protein name:  Intestinal peptide PHI-27-like
  • Gene name:  VIP
  • Organism:  Meleagris gallopavo (Wild turkey)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Meleagris (genus), Meleagridinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0009648 photoperiodism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HADGIFTTVYSHLLAKLAVKRYLHSLI
  • Length:  27
  • Propeptide:  MEHRGTSPLLLALALLSALCWRARALPPRGAAFPAVPRLGNRLPFDAASESDRAHGSLKSESDILQNTLPENEKFYFDLSRIIDRNDRHADGIFTTVYSHLLAKLAVKRYLHSLIRKRVSSQDSPVKRHSDAVFTDNYSRFRKQMAVKKYLNSVLTGKRSQEELNPAKLADEAEILEPSFSENYDDVSVDELLSHLPLDL
  • Signal peptide:  MEHRGTSPLLLALALLSALCWRARA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P45644-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001905_AF2.pdbhor001905_ESM.pdb

Physical Information

Mass: 353159 Formula: C144H228N38O36
Absent amino acids: CEMNPQW Common amino acids: L
pI: 9.93 Basic residues: 6
Polar residues: 7 Hydrophobic residues: 13
Hydrophobicity: 48.89 Boman Index: -907
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 133.7
Instability Index: 561.85 Extinction Coefficient cystines: 2980
Absorbance 280nm: 114.62

Literature

  • PubMed ID:  NA
  • Title:  NA